Pay in 4 interest-free payments of $31.80 Learn more
Ships within 48 hours · Estimated delivery Jul 29 - Aug 3
RRID: AB_2835133
v myc myelocytomatosis viral oncogene homolog
Specificity: GPR135 Antibody detects endogenous levels of total GPR135
DAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG
Swiss-Prot: O60547
TEF (K224) Polyclonal Antibody-BS2041 AffinityImmuno RRID: AB_2835133TEF (K224) Polyclonal Antibody Sizes: 50l, 100l Catalogue Numbers: BS2041 50, BS2041 100 Product: Rabbit IgG, 1mg ml in PBS with 0. 02% sodium azide, 50% glycerol, pH7. 2 Swiss Prot: Q10587 Host: Rabbit Reactivity: Human, Mouse, Rat Applications: IHC All Applications: IHC: 1: 50~1: 200 Background: TEF (thyrotrophic embryonic factor), also known as KIAA1655, is a 303 amino acid nuclear transcription factor that belongs to the bZIP (basic region leucine
US$ 266.50
US$ 200.00
US$ 244.00
US$ 114.50
US$ 207.00
US$ 365.50
US$ 255.50
US$ 255.50
US$ 277.50